ACAD8 Peptide - N-terminal region
ACAD8 Peptide - N-terminal region
Product Specifications
UniProt
B7Z5W4
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ACAD8 Rabbit Polyclonal Antibody (orb582603) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: KFASYCLTEPGSGSDAASLLTSAKKQGDHYILNGSKAFISGAGESDIYVV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TRC-P838440-500MG 500 mg
2-Propynal (>85%, stabilized with Hydroquinone)
Sign In for Pricing
View Details 
BNUB1193-500 1x 500 µL
CD59 (heavy chain of Protectin) (MACIF/1193), 0.2mg/mL
Sign In for Pricing
View Details