ACAD8 Peptide - N-terminal region
ACAD8 Peptide - N-terminal region
Product Specifications
UniProt
B7Z5W4
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ACAD8 Rabbit Polyclonal Antibody (orb582603) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: KFASYCLTEPGSGSDAASLLTSAKKQGDHYILNGSKAFISGAGESDIYVV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![CRMP2 (DPYSL2) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5D7]](https://cdn.genprice.uk/products/937/68dd1b85061270361ea204db/imageurl/ta811601bm.webp)
TA811601BM 100 µL
CRMP2 (DPYSL2) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5D7]
Sign In for Pricing
View Details 
![DICER1 Mouse Monoclonal Antibody [Clone ID: N167/7]](https://cdn.genprice.uk/products/937/68dd1898061270361e8fb429/imageurl/75-196.webp)