Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GIMAP2 Peptide - middle region

GIMAP2 Peptide - middle region

Product Specifications

Product Name Alternative

HIMAP2, IMAP2

UniProt

Q9UG22

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GIMAP2 Rabbit Polyclonal Antibody (orb583043) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_056475

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LVTQLGRYTSQDQQAAQRVKEIFGEDAMGHTIVLFTHKEDLNGGSLMDYM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human GDNF Family Receptor α-1/GFRA1 (C-Fc)
AP75643-01 10 µg

Recombinant Human GDNF Family Receptor α-1/GFRA1 (C-Fc)

Sign In for Pricing
View Details
Recombinant Human GDNF Family Receptor α-1/GFRA1 (C-Fc)
AP75643-02 50 µg

Recombinant Human GDNF Family Receptor α-1/GFRA1 (C-Fc)

Sign In for Pricing
View Details
Recombinant Human GDNF Family Receptor α-1/GFRA1 (C-Fc)
AP75643-03 500 µg

Recombinant Human GDNF Family Receptor α-1/GFRA1 (C-Fc)

Sign In for Pricing
View Details
Recombinant Human GDNF Family Receptor α-1/GFRA1 (C-Fc)
AP75643-04 1 mg

Recombinant Human GDNF Family Receptor α-1/GFRA1 (C-Fc)

Sign In for Pricing
View Details
SMC5 Human shRNA Plasmid Kit (Locus ID 23137)
TL309238 1 Kit

SMC5 Human shRNA Plasmid Kit (Locus ID 23137)

Sign In for Pricing
View Details
HMW-Guanylin CRISPR Activation Plasmid (h)
sc-407711-ACT 20 µg

HMW-Guanylin CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details