Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GIMAP2 Peptide - middle region

GIMAP2 Peptide - middle region

Product Specifications

Product Name Alternative

HIMAP2, IMAP2

UniProt

Q9UG22

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GIMAP2 Rabbit Polyclonal Antibody (orb583043) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_056475

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LVTQLGRYTSQDQQAAQRVKEIFGEDAMGHTIVLFTHKEDLNGGSLMDYM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FEN1 Antibody
OAAN00260-200UL 200 µL

FEN1 Antibody

Sign In for Pricing
View Details
Mitochondrial Respiratory Chain Complex IV Activity Assay Kit (Microanalysis)
CB0095M 100 Tests

Mitochondrial Respiratory Chain Complex IV Activity Assay Kit (Microanalysis)

Sign In for Pricing
View Details
VAMP A Antibody, mAb, Rabbit
A04781-100 100 µL

VAMP A Antibody, mAb, Rabbit

Sign In for Pricing
View Details
Phospho-EGFR (Tyr1173) Rabbit Monoclonal Antibody
AMRe84897-01 1 Each

Phospho-EGFR (Tyr1173) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Phospho-EGFR (Tyr1173) Rabbit Monoclonal Antibody
AMRe84897-02 50 µL

Phospho-EGFR (Tyr1173) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Phospho-EGFR (Tyr1173) Rabbit Monoclonal Antibody
AMRe84897-03 100 µL

Phospho-EGFR (Tyr1173) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details