TEKT5 Peptide - N-terminal region
TEKT5 Peptide - N-terminal region
Product Specifications
UniProt
Q96M29
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with TEKT5 Rabbit Polyclonal Antibody (orb587229) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_653275
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: QVRGAEASRLWASRLTDDSMRLLQDKDQLTHQMQEGTCRNLGQRLSDIGF
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC401619-500 1x 500 µL
CD9 (TSPAN29) (Motility-Related Protein-1) (CD9/1619), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
TRC-P287322-1MG 1 mg
Perhexiline-d11 Maleate (Mixture of Diastereomers)
Sign In for Pricing
View Details 