Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TEKT5 Peptide - N-terminal region

TEKT5 Peptide - N-terminal region

Product Specifications

UniProt

Q96M29

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TEKT5 Rabbit Polyclonal Antibody (orb587229) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_653275

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QVRGAEASRLWASRLTDDSMRLLQDKDQLTHQMQEGTCRNLGQRLSDIGF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4’,6-Diamidino-2-phenylindole Dihydrochloride
TRC-D416050-25MG 25 mg

4’,6-Diamidino-2-phenylindole Dihydrochloride

Sign In for Pricing
View Details
TyraMaxTM 3-Plex Amplification Dye Set with DAPI
#33029 1 Kit

TyraMaxTM 3-Plex Amplification Dye Set with DAPI

Sign In for Pricing
View Details
CXG2 Antibody
8C15876-AAT 50 µg

CXG2 Antibody

Sign In for Pricing
View Details
MXI1 Human Gene Knockout Kit (CRISPR)
KN402332 1 Kit

MXI1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
N-Acetyl-L-cysteine-d3
TRC-A172092-5MG 5 mg

N-Acetyl-L-cysteine-d3

Sign In for Pricing
View Details
FAK Recombinant Rabbit monoclonal Antibody
HA750039 100 µL

FAK Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details