Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NPEPL1 Peptide - N-terminal region

NPEPL1 Peptide - N-terminal region

Product Specifications

UniProt

Q8NDH3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NPEPL1 Rabbit Polyclonal Antibody (orb587569) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CIVMVCEQPEVFASACALARAFPLFTHRSGASRRLEKKTVTVEFFLVGQD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELL Lentiviral Activation Particles (m2)
sc-420159-LAC-2 200 µL

ELL Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details
SKP2 (Phospho-Ser64) Antibody
SAB480P-01 50 µL

SKP2 (Phospho-Ser64) Antibody

Sign In for Pricing
View Details
SKP2 (Phospho-Ser64) Antibody
SAB480P-02 100 µL

SKP2 (Phospho-Ser64) Antibody

Sign In for Pricing
View Details
Mouse Anti Human ACE2 Polyclonal Fractionated
IMSAHUACE2PF400ul 1 Each

Mouse Anti Human ACE2 Polyclonal Fractionated

Sign In for Pricing
View Details
C11orf9 CRISPRa sgRNA lentivector (set of three targets)(Human)
13728121 3x 1.0µg DNA

C11orf9 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
PIGT (GPI Transamidase Component PIG-T, Phosphatidylinositol-glycan Biosynthesis Class T Protein, CGI-06, PSEC0163, UNQ716/PRO1379, FLJ41596, MGC8909) (PE)
131330-PE 100 µL

PIGT (GPI Transamidase Component PIG-T, Phosphatidylinositol-glycan Biosynthesis Class T Protein, CGI-06, PSEC0163, UNQ716/PRO1379, FLJ41596, MGC8909) (PE)

Sign In for Pricing
View Details