NPEPL1 Peptide - N-terminal region
NPEPL1 Peptide - N-terminal region
Product Specifications
UniProt
Q8NDH3
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with NPEPL1 Rabbit Polyclonal Antibody (orb587569) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: CIVMVCEQPEVFASACALARAFPLFTHRSGASRRLEKKTVTVEFFLVGQD
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15137564 1 Vial
Lentiviral mouse Obp1a shRNA (UAS) - Lentiviral mouseObp1a shRNA (UAS, GFP) (25)
Sign In for Pricing
View Details 
GTR10431854 96 Well
Mouse anti ganglioside (GM1) antibody (IgG) ELISA kit
Sign In for Pricing
View Details RC214579L3V 200 µL
MCH2 (MCHR2) (NM_032503) Human Tagged ORF Clone Lentiviral Particle
Sign In for Pricing
View Details