NPIPB15 Peptide - middle region
NPIPB15 Peptide - middle region
Product Specifications
Product Name Alternative
NPIPL2, A-761H5.4
UniProt
A6NHN6
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with NPIPB15 Rabbit Polyclonal Antibody (orb327036) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001293023.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: IRKRKVTTKINRHDKINGKRKTARKQKMFQRAQELRRRAEDYHKCKIPPS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
M2825-14E 50 µg
MDR1 (P-Glycoprotein, Pgp170, MRP1, Multi Drug Resistance Associated Protein, ABCB1, ATP-binding cassette, sub-family B (MDR/TAP), member 1, ABC20, CD243, CD243 antigen, CLCS, GP170) discontinued
Sign In for Pricing
View Details