Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NUP62 Peptide - middle region

NUP62 Peptide - middle region

Product Specifications

Product Name Alternative

IBSN, SNDI, p62

UniProt

P37198

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NUP62 Rabbit Polyclonal Antibody (orb331391) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_714941

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TAPPGPGAAAGAAASSAMTYAQLESLINKWSLELEDQERHFLQQATQVNA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

mCherry Goat Polyclonal Antibody
AB0081-500 1.5 mg

mCherry Goat Polyclonal Antibody

Sign In for Pricing
View Details
HMGA1 Rabbit Polyclonal Antibody
TA377131 100 µL

HMGA1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
NucSpot® 750/780, 1000X in DMSO
#41038 1x 100 µL

NucSpot® 750/780, 1000X in DMSO

Sign In for Pricing
View Details
SB 203580 Hydrochloride
TRC-S155058-50MG 50 mg

SB 203580 Hydrochloride

Sign In for Pricing
View Details
Elab Fluor® Violet 610 Anti-Mouse CD86 Antibody[GL-1]
E-AB-F0994UT-01 25 µg

Elab Fluor® Violet 610 Anti-Mouse CD86 Antibody[GL-1]

Sign In for Pricing
View Details
Elab Fluor® Violet 610 Anti-Mouse CD86 Antibody[GL-1]
E-AB-F0994UT-02 100 µg

Elab Fluor® Violet 610 Anti-Mouse CD86 Antibody[GL-1]

Sign In for Pricing
View Details