Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR1L4 Peptide - C-terminal region

OR1L4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR1L5, OR9-29, OR9-E, OST046

UniProt

Q8NGR5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR1L4 Rabbit Polyclonal Antibody (orb327042) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001005235

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VYFRPLSMYSVMKGRVATVMYTVVTPMLNPFIYSLRNKDMKRGLKKLRHR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(+) -Abscisic Acid-D6
RM-A690345-01 10 mg

(+) -Abscisic Acid-D6

Sign In for Pricing
View Details
(+) -Abscisic Acid-D6
RM-A690345-02 25 mg

(+) -Abscisic Acid-D6

Sign In for Pricing
View Details
(+) -Abscisic Acid-D6
RM-A690345-03 50 mg

(+) -Abscisic Acid-D6

Sign In for Pricing
View Details
(+) -Abscisic Acid-D6
RM-A690345-04 100 mg

(+) -Abscisic Acid-D6

Sign In for Pricing
View Details
Porcine Prenylated Rab acceptor protein 1 (RABAC1) ELISA Kit
GTR10367848 96 Well

Porcine Prenylated Rab acceptor protein 1 (RABAC1) ELISA Kit

Sign In for Pricing
View Details
Rat ADP-ribosylation factor-like protein 6 (ARL6) ELISA Kit
MBS7220199-01 48 Well

Rat ADP-ribosylation factor-like protein 6 (ARL6) ELISA Kit

Sign In for Pricing
View Details