Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR1L4 Peptide - C-terminal region

OR1L4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR1L5, OR9-29, OR9-E, OST046

UniProt

Q8NGR5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR1L4 Rabbit Polyclonal Antibody (orb327042) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001005235

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VYFRPLSMYSVMKGRVATVMYTVVTPMLNPFIYSLRNKDMKRGLKKLRHR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nhp2 3'UTR Luciferase Stable Cell Line
TU213968 1.0 mL

Nhp2 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Rfxap sgRNA CRISPR Lentivector (Rat) (Target 2)
K7497803 1.0 µg DNA

Rfxap sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Human PCDHA13 qPCR Primer Pair
QH46449S 200 Tests

Human PCDHA13 qPCR Primer Pair

Sign In for Pricing
View Details
ViPrimePLUS African Swine Fever Virus (ASFV) qPCR Test Kit
VICA022 1 Kit

ViPrimePLUS African Swine Fever Virus (ASFV) qPCR Test Kit

Sign In for Pricing
View Details
TRDD3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV788540 1.0 µg DNA

TRDD3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
Dystrophin Antibody / DMD
V7548SAF-100UG 100 µg

Dystrophin Antibody / DMD

Sign In for Pricing
View Details