OR4A16 Peptide - C-terminal region
OR4A16 Peptide - C-terminal region
Product Specifications
Product Name Alternative
OR11-117, OR4A16Q
UniProt
Q8NH70
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with OR4A16 Rabbit Polyclonal Antibody (orb587591) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001005274
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: FLLISCGVILNFLKTYSQEERHKALPTCISHIIVVALVFVPCIFMYVRPV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC473063-100 1x 100 µL
CLEC9A / DNGR1 (Dendritic Cell Marker) (8F9), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
