Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR4A16 Peptide - C-terminal region

OR4A16 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR11-117, OR4A16Q

UniProt

Q8NH70

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR4A16 Rabbit Polyclonal Antibody (orb587591) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001005274

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FLLISCGVILNFLKTYSQEERHKALPTCISHIIVVALVFVPCIFMYVRPV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CLEC2L (NM_001080511) Human Over-expression Lysate
LC421066 20 µg

CLEC2L (NM_001080511) Human Over-expression Lysate

Sign In for Pricing
View Details
H-Arg (Pbf) -2-CT Polystyrene Resin
H0370753302.25G 25 g

H-Arg (Pbf) -2-CT Polystyrene Resin

Sign In for Pricing
View Details
CKMT2 (NM_001099736) Human Recombinant Protein
TP316991L 1 mg

CKMT2 (NM_001099736) Human Recombinant Protein

Sign In for Pricing
View Details
Biotin-XX, Succinimidyl Ester (6- ((6- ((B
#90052 1x 100 mg

Biotin-XX, Succinimidyl Ester (6- ((6- ((B

Sign In for Pricing
View Details
Slc22a23 Mouse Gene Knockout Kit (CRISPR)
KN515934 1 Kit

Slc22a23 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
2-Hydroxy-propoxycarbazone
TRC-H185620-25MG 25 mg

2-Hydroxy-propoxycarbazone

Sign In for Pricing
View Details