Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR4F6 Peptide - C-terminal region

OR4F6 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR15-15, OR4F12

UniProt

Q8NGB9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR4F6 Rabbit Polyclonal Antibody (orb587598) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001005326

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FISLASFLILIISYIFILVTVQKKSSGGIFKAFSMLSAHVIVVVLVFGPL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-CREB (Ser133) Rabbit mAb Antibody
orb3015579 100 µL

Phospho-CREB (Ser133) Rabbit mAb Antibody

Sign In for Pricing
View Details
Human OR2H1 full length protein-synthetic nanodisc
E33F100025 10 µg

Human OR2H1 full length protein-synthetic nanodisc

Sign In for Pricing
View Details
Catenin, alpha-1 (CTNNA1) (1G5), CF740 conjugate, 0.1mg/mL
BNC741364-500 1x 500 µL

Catenin, alpha-1 (CTNNA1) (1G5), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cisd1 sgRNA CRISPR Lentivector set (Rat)
K6754501 3x 1.0 µg

Cisd1 sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
PPAR delta Recombinant Rabbit mAb
orb3184953-01 25 µL

PPAR delta Recombinant Rabbit mAb

Sign In for Pricing
View Details
PPAR delta Recombinant Rabbit mAb
orb3184953-02 50 µL

PPAR delta Recombinant Rabbit mAb

Sign In for Pricing
View Details