Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR5H2 Peptide - C-terminal region

OR5H2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR3-10

UniProt

Q8NGV7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR5H2 Rabbit Polyclonal Antibody (orb587617) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001005482

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GAHLLSVSLYYGPLIFMYLRPASPQADDQDMIDSVFYTIIIPLLNPIIYS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Optitrol Paediatric G
SR15017 2x 2.5 mL

Optitrol Paediatric G

Sign In for Pricing
View Details
CLLD7 (RCBTB1) (NM_018191) Human Recombinant Protein
TP314169 20 µg

CLLD7 (RCBTB1) (NM_018191) Human Recombinant Protein

Sign In for Pricing
View Details
BUD31 Polyclonal Antibody
E-AB-18552-01 20 µL

BUD31 Polyclonal Antibody

Sign In for Pricing
View Details
BUD31 Polyclonal Antibody
E-AB-18552-02 60 µL

BUD31 Polyclonal Antibody

Sign In for Pricing
View Details
BUD31 Polyclonal Antibody
E-AB-18552-03 120 µL

BUD31 Polyclonal Antibody

Sign In for Pricing
View Details
BUD31 Polyclonal Antibody
E-AB-18552-04 200 µL

BUD31 Polyclonal Antibody

Sign In for Pricing
View Details