OR5H2 Peptide - C-terminal region
OR5H2 Peptide - C-terminal region
Product Specifications
Product Name Alternative
OR3-10
UniProt
Q8NGV7
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with OR5H2 Rabbit Polyclonal Antibody (orb587617) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001005482
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: GAHLLSVSLYYGPLIFMYLRPASPQADDQDMIDSVFYTIIIPLLNPIIYS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![BCL2 Mouse Monoclonal Antibody [Clone ID: OTI3H10]](https://cdn.genprice.uk/products/937/68dd18b9061270361e908286/imageurl/cf806592.webp)
![Elab Fluor® Violet 610 Anti-Human CD11b Antibody[ICRF44]](https://cdn.genprice.uk/products/763/68dd14b0061270361e7d3d01/imageurl/e-ab-f1146t.webp)
E-AB-F1146T-01 20 Tests
Elab Fluor® Violet 610 Anti-Human CD11b Antibody[ICRF44]
Sign In for Pricing
View Details E-AB-F1146T-02 100 Tests
Elab Fluor® Violet 610 Anti-Human CD11b Antibody[ICRF44]
Sign In for Pricing
View Details E-AB-F1146T-03 2x 100 Tests
Elab Fluor® Violet 610 Anti-Human CD11b Antibody[ICRF44]
Sign In for Pricing
View Details ![CINP Mouse Monoclonal Antibody [Clone ID: OTI5A11]](https://cdn.genprice.uk/products/937/68dd18bb061270361e908d15/imageurl/cf812289.webp)
