Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR5H15 Peptide - C-terminal region

OR5H15 Peptide - C-terminal region

Product Specifications

UniProt

A6NDH6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR5H15 Rabbit Polyclonal Antibody (orb587618) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001005515

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FLMVFIFSGSIQVFSIVTILISYTFVLFTVLEKKSDKGVRKAFSTCGAHL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Melatonin Receptor 1B (MTNR1B) Goat Polyclonal Antibody
AP31974PU-N 100 µg

Melatonin Receptor 1B (MTNR1B) Goat Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human MIF protein (GST tag)
PDEH100754-01 20 µg

Recombinant Human MIF protein (GST tag)

Sign In for Pricing
View Details
Recombinant Human MIF protein (GST tag)
PDEH100754-02 100 µg

Recombinant Human MIF protein (GST tag)

Sign In for Pricing
View Details
Recombinant Human MIF protein (GST tag)
PDEH100754-03 500 µg

Recombinant Human MIF protein (GST tag)

Sign In for Pricing
View Details
Recombinant Human MIF protein (GST tag)
PDEH100754-04 1 mg

Recombinant Human MIF protein (GST tag)

Sign In for Pricing
View Details
PGAM1 antibody
FNab09874 100 µg

PGAM1 antibody

Sign In for Pricing
View Details