OR5H15 Peptide - C-terminal region
OR5H15 Peptide - C-terminal region
Product Specifications
UniProt
A6NDH6
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with OR5H15 Rabbit Polyclonal Antibody (orb587618) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001005515
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: FLMVFIFSGSIQVFSIVTILISYTFVLFTVLEKKSDKGVRKAFSTCGAHL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LY419682 100 µg
Alpha B Crystallin (CRYAB) (NM_001885) Human Over-expression Lysate
Sign In for Pricing
View Details ![Creatine kinase B type Recombinant Rabbit Monoclonal Antibody [JB78-34]](https://cdn.genprice.uk/products/992/68dd1c90061270361ea82b2c/imageurl/et7107-52.webp)
ET7107-52 100 µL
Creatine kinase B type Recombinant Rabbit Monoclonal Antibody [JB78-34]
Sign In for Pricing
View Details 
LY402584 100 µg
NADPH oxidase 4 (NOX4) (NM_016931) Human Over-expression Lysate
Sign In for Pricing
View Details 