WDR59 Peptide - N-terminal region
WDR59 Peptide - N-terminal region
Product Specifications
UniProt
Q6PJI9
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with WDR59 Rabbit Polyclonal Antibody (orb327145) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: APMKIRTEAPGNLRLYSGSPTRSEKEQVSISSFYYKERKSRRWKSKREGS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![iFluor™ 594 Conjugated beta Tubulin Recombinant Mouse Monoclonal Antibody [A1-A4-R]](https://cdn.genprice.uk/products/992/68dd1c8d061270361ea8213b/imageurl/ha600110f.webp)
HA600110F 100 µL
iFluor™ 594 Conjugated beta Tubulin Recombinant Mouse Monoclonal Antibody [A1-A4-R]
Sign In for Pricing
View Details 
LC400304 20 µg
Metabotropic Glutamate Receptor 1 (GRM1) (NM_000838) Human Over-expression Lysate
Sign In for Pricing
View Details 