WDR59 Peptide - N-terminal region
WDR59 Peptide - N-terminal region
Product Specifications
UniProt
Q6PJI9
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with WDR59 Rabbit Polyclonal Antibody (orb327145) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: APMKIRTEAPGNLRLYSGSPTRSEKEQVSISSFYYKERKSRRWKSKREGS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
AP31068PU-N 100 µg
Adenosine Receptor A2a (ADORA2A) (C-term) Goat Polyclonal Antibody
Sign In for Pricing
View Details 
