Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WDR59 Peptide - C-terminal region

WDR59 Peptide - C-terminal region

Product Specifications

UniProt

Q6PJI9

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with WDR59 Rabbit Polyclonal Antibody (orb327146) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_085058

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TRSEKEQVSISSFYYKERKSRRWKSKREGSDSGNRQIKAAGKVIIQDIAC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Acetyl-Histone H3.1 (Lys28) Recombinant Antibody, APC Conjugated
bsm-62460R-APC-01 20 µL

Acetyl-Histone H3.1 (Lys28) Recombinant Antibody, APC Conjugated

Sign In for Pricing
View Details
Acetyl-Histone H3.1 (Lys28) Recombinant Antibody, APC Conjugated
bsm-62460R-APC-02 100 µL

Acetyl-Histone H3.1 (Lys28) Recombinant Antibody, APC Conjugated

Sign In for Pricing
View Details
AP1M2 Rabbit Polyclonal Antibody
TA340065 100 µL

AP1M2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PLEKHG3 CRISPR/Cas9 KO Plasmid (h)
sc-411863 20 µg

PLEKHG3 CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details
Recombinant Human Butyrophilin 1A1/BTN1A1 Protein (His Tag)
PKSH032132-01 10 µg

Recombinant Human Butyrophilin 1A1/BTN1A1 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human Butyrophilin 1A1/BTN1A1 Protein (His Tag)
PKSH032132-02 50 µg

Recombinant Human Butyrophilin 1A1/BTN1A1 Protein (His Tag)

Sign In for Pricing
View Details