Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WDR59 Peptide - C-terminal region

WDR59 Peptide - C-terminal region

Product Specifications

UniProt

Q6PJI9

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with WDR59 Rabbit Polyclonal Antibody (orb327146) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_085058

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TRSEKEQVSISSFYYKERKSRRWKSKREGSDSGNRQIKAAGKVIIQDIAC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Agar Medium L (Brilliant Green, Phenol Red, Lactose Monohydrate, Sucrose Agar)
ME016-500G 500 g

Agar Medium L (Brilliant Green, Phenol Red, Lactose Monohydrate, Sucrose Agar)

Sign In for Pricing
View Details
Rat Fbxo27 Pre-designed siRNA Set B
SI204939B 1 Each

Rat Fbxo27 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Cy7.5 PEG-N3
HY-D2590 1 Each

Cy7.5 PEG-N3

Sign In for Pricing
View Details
Leukemia Inhibitory Factor Receptor (LIFR, SJS2, CD118, STWS, SWS)
141255 200 µL

Leukemia Inhibitory Factor Receptor (LIFR, SJS2, CD118, STWS, SWS)

Sign In for Pricing
View Details
Endoplasmic Reticulum Protein 29 (ERP29), Recombinant, Rat, His-Tag
049662-01 10 µg

Endoplasmic Reticulum Protein 29 (ERP29), Recombinant, Rat, His-Tag

Sign In for Pricing
View Details
Endoplasmic Reticulum Protein 29 (ERP29), Recombinant, Rat, His-Tag
049662-02 50 µg

Endoplasmic Reticulum Protein 29 (ERP29), Recombinant, Rat, His-Tag

Sign In for Pricing
View Details