WWC2 Peptide - C-terminal region
WWC2 Peptide - C-terminal region
Product Specifications
UniProt
Q6AWC2
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with WWC2 Rabbit Polyclonal Antibody (orb327148) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: RLLKQAEKQAEQSKEEQKQGLNAEKLMRQVSKDVCRLREQSQKVPRQVQS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TP324778 20 µg
RANKL (TNFSF11) (NM_033012) Human Recombinant Protein
Sign In for Pricing
View Details 
AN300363P-01 20 µL
Recombinant Phospho-p70 S6 Kinase 1 (Thr389) Monoclonal Antibody
Sign In for Pricing
View Details