Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WWC2 Peptide - C-terminal region

WWC2 Peptide - C-terminal region

Product Specifications

UniProt

Q6AWC2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with WWC2 Rabbit Polyclonal Antibody (orb327148) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RLLKQAEKQAEQSKEEQKQGLNAEKLMRQVSKDVCRLREQSQKVPRQVQS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BLK Mouse Monoclonal Antibody [Clone ID: 1E6]
AM06549SU-N 100 µL

BLK Mouse Monoclonal Antibody [Clone ID: 1E6]

Sign In for Pricing
View Details
Human Serine Palmitoyltransferase, Long Chain Base Subunit 3 (SPTLC3) ELISA Kit
RDR-SPTLC3-Hu-01 96 Tests

Human Serine Palmitoyltransferase, Long Chain Base Subunit 3 (SPTLC3) ELISA Kit

Sign In for Pricing
View Details
Human Serine Palmitoyltransferase, Long Chain Base Subunit 3 (SPTLC3) ELISA Kit
RDR-SPTLC3-Hu-02 48 Tests

Human Serine Palmitoyltransferase, Long Chain Base Subunit 3 (SPTLC3) ELISA Kit

Sign In for Pricing
View Details
Recombinant Human NOS2/INOS Protein (Trx Tag)
PDEH100624-01 20 µg

Recombinant Human NOS2/INOS Protein (Trx Tag)

Sign In for Pricing
View Details
Recombinant Human NOS2/INOS Protein (Trx Tag)
PDEH100624-02 100 µg

Recombinant Human NOS2/INOS Protein (Trx Tag)

Sign In for Pricing
View Details
Recombinant Human NOS2/INOS Protein (Trx Tag)
PDEH100624-03 500 µg

Recombinant Human NOS2/INOS Protein (Trx Tag)

Sign In for Pricing
View Details