Hoxc6 Peptide - middle region
Hoxc6 Peptide - middle region
Product Specifications
UniProt
G3V841
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Hoxc6 Rabbit Polyclonal Antibody (orb573757) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
XP_003750463
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: DFSSEQGRTAPQDQKASIQIYPWMQRMNSHSGVGYGADRRRGRQIYSRYQ
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LC424734 20 µg
CD41 (ITGA2B) (NM_000419) Human Over-expression Lysate
Sign In for Pricing
View Details 
11306-AAT 200 Tests
Amplite® Fluorimetric Catalase Assay Kit *Red Fluorescence*
Sign In for Pricing
View Details 
BNC470133-500 1x 500 µL
Hepatocyte Specific Antigen (HSA133), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details