Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hoxc6 Peptide - middle region

Hoxc6 Peptide - middle region

Product Specifications

UniProt

G3V841

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Hoxc6 Rabbit Polyclonal Antibody (orb573757) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_003750463

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DFSSEQGRTAPQDQKASIQIYPWMQRMNSHSGVGYGADRRRGRQIYSRYQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DLK (DLK1) (NM_003836) Human Over-expression Lysate
LY401257 100 µg

DLK (DLK1) (NM_003836) Human Over-expression Lysate

Sign In for Pricing
View Details
Phospho-Tuberin (S939) Recombinant Rabbit Monoclonal Antibody [JE54-06]
HA721762 100 µL

Phospho-Tuberin (S939) Recombinant Rabbit Monoclonal Antibody [JE54-06]

Sign In for Pricing
View Details
Uncoated Human FOLR1 (Folate Receptor 1) ELISA Kit
E-UNEL-H0360-01 5x 96 Tests

Uncoated Human FOLR1 (Folate Receptor 1) ELISA Kit

Sign In for Pricing
View Details
Uncoated Human FOLR1 (Folate Receptor 1) ELISA Kit
E-UNEL-H0360-02 15x 96 Tests

Uncoated Human FOLR1 (Folate Receptor 1) ELISA Kit

Sign In for Pricing
View Details
Human FAM113B (PCED1B) activation kit by CRISPRa
GA114121 1 Kit

Human FAM113B (PCED1B) activation kit by CRISPRa

Sign In for Pricing
View Details
Biotin Conjugated Goat Polyclonal Antibody to Human IgA,
BAT-2101-2 2 mL

Biotin Conjugated Goat Polyclonal Antibody to Human IgA,

Sign In for Pricing
View Details