Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EYA3 Peptide - N-terminal region

EYA3 Peptide - N-terminal region

Product Specifications

UniProt

Q0P685

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EYA3 Rabbit Polyclonal Antibody (orb574142) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KMQESGEQTISQVSNPDVSDQKPETSSLASNLPMSEEIMTCTDYIPRSSN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sacituzumab (Reference antibody)
E55B0748 100 µg

Sacituzumab (Reference antibody)

Sign In for Pricing
View Details
Pig CD163 Antibody
E55A15625 100 µg

Pig CD163 Antibody

Sign In for Pricing
View Details
WBSCR11 Double Nickase Plasmid (m)
sc-425337-NIC 20 µg

WBSCR11 Double Nickase Plasmid (m)

Sign In for Pricing
View Details
Mouse Myosin-IIIa, Myo3a ELISA KIT
ELI-38366m 96 Tests

Mouse Myosin-IIIa, Myo3a ELISA KIT

Sign In for Pricing
View Details
Methyl 2-bromovalerate
283451-01 100 mg

Methyl 2-bromovalerate

Sign In for Pricing
View Details
Methyl 2-bromovalerate
283451-02 250 mg

Methyl 2-bromovalerate

Sign In for Pricing
View Details