Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EYA3 Peptide - N-terminal region

EYA3 Peptide - N-terminal region

Product Specifications

UniProt

Q0P685

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EYA3 Rabbit Polyclonal Antibody (orb574142) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KMQESGEQTISQVSNPDVSDQKPETSSLASNLPMSEEIMTCTDYIPRSSN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Ecto-NOX disulfide-thiol exchanger 1(ENOX1)
AP77499-01 20 µg

Recombinant Human Ecto-NOX disulfide-thiol exchanger 1(ENOX1)

Sign In for Pricing
View Details
Recombinant Human Ecto-NOX disulfide-thiol exchanger 1(ENOX1)
AP77499-02 100 µg

Recombinant Human Ecto-NOX disulfide-thiol exchanger 1(ENOX1)

Sign In for Pricing
View Details
Recombinant Human Ecto-NOX disulfide-thiol exchanger 1(ENOX1)
AP77499-03 1 mg

Recombinant Human Ecto-NOX disulfide-thiol exchanger 1(ENOX1)

Sign In for Pricing
View Details
3-Benzyloxy-5-chloro-2-ethoxypyridine
OR345236 1 Each

3-Benzyloxy-5-chloro-2-ethoxypyridine

Sign In for Pricing
View Details
Recombinant Hepatitis C virus Genome polyprotein
MBS7037962-01 0.02 mg

Recombinant Hepatitis C virus Genome polyprotein

Sign In for Pricing
View Details
Recombinant Hepatitis C virus Genome polyprotein
MBS7037962-02 0.1 mg

Recombinant Hepatitis C virus Genome polyprotein

Sign In for Pricing
View Details