Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PARP12 Peptide - C-terminal region

PARP12 Peptide - C-terminal region

Product Specifications

UniProt

G5E9U9

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PARP12 Rabbit Polyclonal Antibody (orb574818) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PTIYRNAHDIKNKSSAPSRVPPLFVPQGTSERKDSSGSVSPNTLSQEEGD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NLRP2 Rabbit Polyclonal Antibody (Fluoro550)
orb3104891 100 µg

NLRP2 Rabbit Polyclonal Antibody (Fluoro550)

Sign In for Pricing
View Details
Stearic-18-13C acid
TRC-S686509-25MG 25 mg

Stearic-18-13C acid

Sign In for Pricing
View Details
SCAMP5 CRISPRa sgRNA lentivector (set of three targets)(Human)
43088121 3x 1.0µg DNA

SCAMP5 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
Alpha Dystroglycan (DAG1) (NM_001177641) Human Tagged ORF Clone
RC230571 10 µg

Alpha Dystroglycan (DAG1) (NM_001177641) Human Tagged ORF Clone

Sign In for Pricing
View Details
DUSP15, CT (Dual-specificity Protein Phosphatase 15, Vaccinia Virus VH1-Related Dual-specific Protein Phosphatase Y, VH1-related Member Y, C20orf57, VHY) (APC) discontinued
D9840-49-APC 200 µL

DUSP15, CT (Dual-specificity Protein Phosphatase 15, Vaccinia Virus VH1-Related Dual-specific Protein Phosphatase Y, VH1-related Member Y, C20orf57, VHY) (APC) discontinued

Sign In for Pricing
View Details
Fam195b sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K6437707 1.0 µg DNA

Fam195b sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details