Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PARP12 Peptide - C-terminal region

PARP12 Peptide - C-terminal region

Product Specifications

UniProt

G5E9U9

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PARP12 Rabbit Polyclonal Antibody (orb574818) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PTIYRNAHDIKNKSSAPSRVPPLFVPQGTSERKDSSGSVSPNTLSQEEGD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Nlgn3 / Neuroligin-3 Recombinant Protein
R12018m 1 Each

Mouse Nlgn3 / Neuroligin-3 Recombinant Protein

Sign In for Pricing
View Details
Anti-ZWINT Antibody Picoband® Fluoro647 Conjugated
A07023-Fluoro647 100 µg/Vial

Anti-ZWINT Antibody Picoband® Fluoro647 Conjugated

Sign In for Pricing
View Details
Rabbit anti-CBX5 IHC Antibody, Affinity Purified
MBS3907480-01 0.005 mg

Rabbit anti-CBX5 IHC Antibody, Affinity Purified

Sign In for Pricing
View Details
Rabbit anti-CBX5 IHC Antibody, Affinity Purified
MBS3907480-02 5x 0.0005 mg

Rabbit anti-CBX5 IHC Antibody, Affinity Purified

Sign In for Pricing
View Details
Rabbit anti-CBX5 IHC Antibody, Affinity Purified
MBS3907480-03 5x 0.005 mg

Rabbit anti-CBX5 IHC Antibody, Affinity Purified

Sign In for Pricing
View Details
GRHL2 Polyclonal Antibody
A72702-050 50 µL

GRHL2 Polyclonal Antibody

Sign In for Pricing
View Details