Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRRC14 Peptide - N-terminal region

LRRC14 Peptide - N-terminal region

Product Specifications

Product Name Alternative

LRRC14

UniProt

Q15048

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LRRC14 Rabbit Polyclonal Antibody (orb575036) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055480

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QQLLQECAHCSRALLQERPSTESMQAVILGLTARLHTSEPGASTQPLCRK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant (HEK) Human FcGR2a/CD32 Protein (167Arg, 1-218aa, >95%, his-tag, ~30 kda, low endotoxins), active
FCGR2A22-R-25 25 µg

Recombinant (HEK) Human FcGR2a/CD32 Protein (167Arg, 1-218aa, >95%, his-tag, ~30 kda, low endotoxins), active

Sign In for Pricing
View Details
TRNAE39P Protein Vector (Human) (pPM-C-HA)
PV138700 500 ng

TRNAE39P Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Frozen Tissue Sections, Stomach
CS646963 5x 5 µm

Frozen Tissue Sections, Stomach

Sign In for Pricing
View Details
nm23-H7 Lentiviral Activation Particles (h)
sc-403079-LAC 200 µL

nm23-H7 Lentiviral Activation Particles (h)

Sign In for Pricing
View Details
Fli1 ORF Vector (Rat) (pORF)
20604016 1.0 µg DNA

Fli1 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
DEFB128 AAV Vector (Human) (CMV)
17950101 1 µg

DEFB128 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details