Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRRC14 Peptide - N-terminal region

LRRC14 Peptide - N-terminal region

Product Specifications

Product Name Alternative

LRRC14

UniProt

Q15048

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LRRC14 Rabbit Polyclonal Antibody (orb575036) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055480

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QQLLQECAHCSRALLQERPSTESMQAVILGLTARLHTSEPGASTQPLCRK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Aeromonas hydrophila subsp.hydrophila DNA ligase (ligA), partial
MBS1209877 Inquire

Recombinant Aeromonas hydrophila subsp.hydrophila DNA ligase (ligA), partial

Sign In for Pricing
View Details
AATK ORF Vector (Human) (pORF)
11003011 1.0 µg DNA

AATK ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Canine Hemoglobin ELISA Kit
MBS136355-01 1 Kit

Canine Hemoglobin ELISA Kit

Sign In for Pricing
View Details
Canine Hemoglobin ELISA Kit
MBS136355-02 5x 1 Kit

Canine Hemoglobin ELISA Kit

Sign In for Pricing
View Details
Pgp (NM_025954) Mouse Tagged Lenti ORF Clone
MR216973L4 10 µg

Pgp (NM_025954) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Cardiac Troponin I (TNNI3) (1-23) Mouse Monoclonal Antibody [Clone ID: B163M]
AM05139PU-N 1 mg

Cardiac Troponin I (TNNI3) (1-23) Mouse Monoclonal Antibody [Clone ID: B163M]

Sign In for Pricing
View Details