Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SCN7A Peptide - N-terminal region

SCN7A Peptide - N-terminal region

Product Specifications

UniProt

F8WD82

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SCN7A Rabbit Polyclonal Antibody (orb575376) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PFIYGNLSQGMVSEPLEDVDPYYYKKKNTFIVLNKNRTIFRFNAASILCT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Elab Fluor® 700 Anti-Mouse Perforin Antibody[S16009A]
E-AB-F1294UM1-01 25 µg

Elab Fluor® 700 Anti-Mouse Perforin Antibody[S16009A]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Mouse Perforin Antibody[S16009A]
E-AB-F1294UM1-02 100 µg

Elab Fluor® 700 Anti-Mouse Perforin Antibody[S16009A]

Sign In for Pricing
View Details
Tissue Total RNA, Kidney
CR559560 5 µg

Tissue Total RNA, Kidney

Sign In for Pricing
View Details
EGFR Antibody
KC-6438-01 50 μL

EGFR Antibody

Sign In for Pricing
View Details
EGFR Antibody
KC-6438-02 100 µL

EGFR Antibody

Sign In for Pricing
View Details
EGFR Antibody
KC-6438-03 1 mL

EGFR Antibody

Sign In for Pricing
View Details