SCN7A Peptide - N-terminal region
SCN7A Peptide - N-terminal region
Product Specifications
UniProt
F8WD82
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SCN7A Rabbit Polyclonal Antibody (orb575376) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: PFIYGNLSQGMVSEPLEDVDPYYYKKKNTFIVLNKNRTIFRFNAASILCT
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TRC-E892077-25MG 25 mg
(11b)-21-(1-Ethoxyethoxy)-11,17-dihydroxy-pregn-4-ene-3,20-dione-d7
Sign In for Pricing
View Details 
PKSV030154 100 µg
Recombinant EBOV (subtype Zaire, strain H.sapiens-wt/GIN/2014/Kissidougou-C15) Glycoprotein / GP-RBD Protein (His Tag)
Sign In for Pricing
View Details 
