Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KCNK4 Peptide - N-terminal region

KCNK4 Peptide - N-terminal region

Product Specifications

UniProt

Q9NYG8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KCNK4 Rabbit Polyclonal Antibody (orb575425) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LVSGALVFRALEQPHEQQAQRELGEVREKFLRAHPCVSDQELGLLIKEVA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chromogranin A (CHGA/798), 0.2mg/mL
BNUB0798-100 1x 100 µL

Chromogranin A (CHGA/798), 0.2mg/mL

Sign In for Pricing
View Details
PRRT2 Mouse Monoclonal Antibody [Clone ID: OTI9H8]
CF809867 100 µg

PRRT2 Mouse Monoclonal Antibody [Clone ID: OTI9H8]

Sign In for Pricing
View Details
TRAFD1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3E8]
TA809366BM 100 µL

TRAFD1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3E8]

Sign In for Pricing
View Details
Human GPR10 (PRLHR) activation kit by CRISPRa
GA101899 1 Kit

Human GPR10 (PRLHR) activation kit by CRISPRa

Sign In for Pricing
View Details
MAFK Mouse Monoclonal Antibody [Clone ID: AT2F7]
AM50032PU-N 100 µL

MAFK Mouse Monoclonal Antibody [Clone ID: AT2F7]

Sign In for Pricing
View Details
Frozen Tissue Sections, Duodenum
CS650740 5x 5 µm

Frozen Tissue Sections, Duodenum

Sign In for Pricing
View Details