Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC17 Peptide - N-terminal region

CCDC17 Peptide - N-terminal region

Product Specifications

UniProt

Q96LX7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCDC17 Rabbit Polyclonal Antibody (orb575854) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001177111

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ARIQELQAEPGNPLSSRREAELYSPVQKANPGTLAAEIRALREAYIRDGG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AQP1 antibody
70R-51451 100 ul

AQP1 antibody

Sign In for Pricing
View Details
ADCY10 Protein Vector (Human) (pPM-C-HA)
PV061263 500 ng

ADCY10 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Rabbit Polyclonal Exosome component 4 Antibody [mFluor Violet 450 SE]
NBP2-97799MFV450 0.1 mL

Rabbit Polyclonal Exosome component 4 Antibody [mFluor Violet 450 SE]

Sign In for Pricing
View Details
Lentiviral mouse Mettl15 shRNA (UAS) - Lentiviral mouse Mettl15 shRNA (UAS, GFP) plasmid
GTR15275350 1 Vial

Lentiviral mouse Mettl15 shRNA (UAS) - Lentiviral mouse Mettl15 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Plumieride
MBS5762968 Inquire

Plumieride

Sign In for Pricing
View Details
CAY10621
HY-117563 1 mg (22.95 mM x 100 μL in Methyl Acetate)

CAY10621

Sign In for Pricing
View Details