Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC17 Peptide - N-terminal region

CCDC17 Peptide - N-terminal region

Product Specifications

UniProt

Q96LX7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCDC17 Rabbit Polyclonal Antibody (orb575854) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001177111

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ARIQELQAEPGNPLSSRREAELYSPVQKANPGTLAAEIRALREAYIRDGG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPN (Leukosialin, Galactoglycoprotein, GALGP, Leukocyte Sialoglycoprotein, Sialophorin, CD43) (MaxLight 650)
MBS6394957-01 0.1 mL

SPN (Leukosialin, Galactoglycoprotein, GALGP, Leukocyte Sialoglycoprotein, Sialophorin, CD43) (MaxLight 650)

Sign In for Pricing
View Details
SPN (Leukosialin, Galactoglycoprotein, GALGP, Leukocyte Sialoglycoprotein, Sialophorin, CD43) (MaxLight 650)
MBS6394957-02 5x 0.1 mL

SPN (Leukosialin, Galactoglycoprotein, GALGP, Leukocyte Sialoglycoprotein, Sialophorin, CD43) (MaxLight 650)

Sign In for Pricing
View Details
Monkey SPARC (SPARC) ELISA kit
GTR10463090 96 Well

Monkey SPARC (SPARC) ELISA kit

Sign In for Pricing
View Details
Recombinant Microcebus murinus Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 (ASZ1)
MBS1370291-01 0.02 mg (E-Coli)

Recombinant Microcebus murinus Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 (ASZ1)

Sign In for Pricing
View Details
Recombinant Microcebus murinus Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 (ASZ1)
MBS1370291-02 0.02 mg (Yeast)

Recombinant Microcebus murinus Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 (ASZ1)

Sign In for Pricing
View Details
Recombinant Microcebus murinus Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 (ASZ1)
MBS1370291-03 0.1 mg (E-Coli)

Recombinant Microcebus murinus Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 (ASZ1)

Sign In for Pricing
View Details