Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

G3BP1 Peptide - N-terminal region

G3BP1 Peptide - N-terminal region

Product Specifications

UniProt

F5H4D6

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with G3BP1 Rabbit Polyclonal Antibody (orb329869) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PEPEQEPVSEIQEEKPEPVLEETAPEDAQKSSSPAPADIAQTVQEDLRTF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF114 Protein Vector (Human) (pPB-N-His)
PV060026 500 ng

ZNF114 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Mouse Aquaporin 9 (AQP9) Protein
abx167407-01 10 µg

Mouse Aquaporin 9 (AQP9) Protein

Sign In for Pricing
View Details
Mouse Aquaporin 9 (AQP9) Protein
abx167407-02 50 µg

Mouse Aquaporin 9 (AQP9) Protein

Sign In for Pricing
View Details
Mouse Aquaporin 9 (AQP9) Protein
abx167407-03 100 µg

Mouse Aquaporin 9 (AQP9) Protein

Sign In for Pricing
View Details
Mouse Aquaporin 9 (AQP9) Protein
abx167407-04 200 µg

Mouse Aquaporin 9 (AQP9) Protein

Sign In for Pricing
View Details
Mouse Aquaporin 9 (AQP9) Protein
abx167407-05 500 µg

Mouse Aquaporin 9 (AQP9) Protein

Sign In for Pricing
View Details