Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

G3BP1 Peptide - N-terminal region

G3BP1 Peptide - N-terminal region

Product Specifications

UniProt

F5H4D6

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with G3BP1 Rabbit Polyclonal Antibody (orb329869) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PEPEQEPVSEIQEEKPEPVLEETAPEDAQKSSSPAPADIAQTVQEDLRTF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Papillomavirus Type 16,HPV16 ELISA KIT
JOT-EKD0084Hu 96 wells

Human Papillomavirus Type 16,HPV16 ELISA KIT

Sign In for Pricing
View Details
E2F-6 (E-3) X
sc-398677 X 200 µg - 0.1 mL

E2F-6 (E-3) X

Sign In for Pricing
View Details
GENLISA Human Carbohydrate Sulfotransferase 13 (CHST13) ELISA
KBH8562 1x 96 Well

GENLISA Human Carbohydrate Sulfotransferase 13 (CHST13) ELISA

Sign In for Pricing
View Details
OsCht9 Rabbit pAb
orb2706102-01 50 µL

OsCht9 Rabbit pAb

Sign In for Pricing
View Details
OsCht9 Rabbit pAb
orb2706102-02 100 µL

OsCht9 Rabbit pAb

Sign In for Pricing
View Details
Autophagy Related 4D Cysteine Peptidase (ATG4D) Antibody (ATTO 565)
abx447780 100 µg

Autophagy Related 4D Cysteine Peptidase (ATG4D) Antibody (ATTO 565)

Sign In for Pricing
View Details