Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF202 Peptide - C-terminal region

ZNF202 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ZSCAN42, ZKSCAN10

UniProt

O95125

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF202 Rabbit Polyclonal Antibody (orb576638) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001288708.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LIKHQRAHAGGKPHVCRECGQGFSRQSHLIRHQRTHSGEKPYICRKCGRG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Meis1 Mouse Gene Knockout Kit (CRISPR)
KN309965BN 1 Kit

Meis1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ThioStar® Thiol Detection System
L002-250UG 250 µg

ThioStar® Thiol Detection System

Sign In for Pricing
View Details
Tissue FFPE Sections, Bone: tibia, proximal
CS710729 5x 5 µm

Tissue FFPE Sections, Bone: tibia, proximal

Sign In for Pricing
View Details
Usp2 Mouse Gene Knockout Kit (CRISPR)
KN518778 1 Kit

Usp2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
p16INK4A (CDKN2A) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4E11]
TA809937BM 100 µL

p16INK4A (CDKN2A) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4E11]

Sign In for Pricing
View Details
Human YWHAH-AS1 activation kit by CRISPRa
GA108528 1 Kit

Human YWHAH-AS1 activation kit by CRISPRa

Sign In for Pricing
View Details