Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF202 Peptide - C-terminal region

ZNF202 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ZSCAN42, ZKSCAN10

UniProt

O95125

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF202 Rabbit Polyclonal Antibody (orb576638) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001288708.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LIKHQRAHAGGKPHVCRECGQGFSRQSHLIRHQRTHSGEKPYICRKCGRG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EPN
TRC-E588900-250MG 250 mg

EPN

Sign In for Pricing
View Details
Z-His-Phe-OH TFA Salt (80%)
TRC-A387305-25MG 25 mg

Z-His-Phe-OH TFA Salt (80%)

Sign In for Pricing
View Details
Mouse Htr3b activation kit by CRISPRa
GA206124 1 Kit

Mouse Htr3b activation kit by CRISPRa

Sign In for Pricing
View Details
5-(2,2,2-Trifluoroacetyl)-2-thiophenecarboxylic Acid Ethyl Ester
TRC-T789755-250MG 250 mg

5-(2,2,2-Trifluoroacetyl)-2-thiophenecarboxylic Acid Ethyl Ester

Sign In for Pricing
View Details
Human PPM1K activation kit by CRISPRa
GA115848 1 Kit

Human PPM1K activation kit by CRISPRa

Sign In for Pricing
View Details
TECPR1 Antibody
KC-779-01 50 μL

TECPR1 Antibody

Sign In for Pricing
View Details