DHODH Peptide - N-terminal region
DHODH Peptide - N-terminal region
Product Specifications
Product Name Alternative
DHODH
UniProt
Q02127
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with DHODH Rabbit Polyclonal Antibody (orb578282) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001352
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: RARFQDSDMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![PE/Elab Fluor® 594 Rat IgG2b, κ Isotype Control[LTF-2]](https://cdn.genprice.uk/products/763/68dd14ab061270361e7d2854/imageurl/e-ab-f09842p.webp)
E-AB-F09842P-01 20 Tests
PE/Elab Fluor® 594 Rat IgG2b, κ Isotype Control[LTF-2]
Sign In for Pricing
View Details E-AB-F09842P-02 100 Tests
PE/Elab Fluor® 594 Rat IgG2b, κ Isotype Control[LTF-2]
Sign In for Pricing
View Details E-AB-F09842P-03 2x 100 Tests
PE/Elab Fluor® 594 Rat IgG2b, κ Isotype Control[LTF-2]
Sign In for Pricing
View Details