Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DHODH Peptide - N-terminal region

DHODH Peptide - N-terminal region

Product Specifications

Product Name Alternative

DHODH

UniProt

Q02127

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DHODH Rabbit Polyclonal Antibody (orb578282) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001352

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RARFQDSDMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Major Vault Protein (MVP) (VP2897R), CF647 conjugate, 0.1mg/mL
BNC472897-500 1x 500 µL

Major Vault Protein (MVP) (VP2897R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
1-Nitropiperazine-d8
TRC-N518292-1MG 1 mg

1-Nitropiperazine-d8

Sign In for Pricing
View Details
Recombinant Mouse IL-24 protein (His Tag)
PKSM041470-01 20 µg

Recombinant Mouse IL-24 protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse IL-24 protein (His Tag)
PKSM041470-02 100 µg

Recombinant Mouse IL-24 protein (His Tag)

Sign In for Pricing
View Details
CD45RB (B-Cell Marker) (rPTPRC/1132), CF405S conjugate, 0.1mg/mL
BNC043461-100 1x 100 µL

CD45RB (B-Cell Marker) (rPTPRC/1132), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant IKZF3 Antibody
RC-5760-01 50 μL

Recombinant IKZF3 Antibody

Sign In for Pricing
View Details