Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VPS8 Peptide - N-terminal region

VPS8 Peptide - N-terminal region

Product Specifications

UniProt

C9JP71

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with VPS8 Rabbit Polyclonal Antibody (orb325060) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SKFSYIDMDKELEFKNDLIDDKEFDIPQVDTPPTLESILNETDDEDESFI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glucagon Receptor Antibody HRP Conjugated
orb1542298 100 µL

Glucagon Receptor Antibody HRP Conjugated

Sign In for Pricing
View Details
SLC7A8 (C-Term) Rabbit pAb
E2620286 100 µL

SLC7A8 (C-Term) Rabbit pAb

Sign In for Pricing
View Details
ASPH Antibody Blocking peptide
orb1457828 500 µg

ASPH Antibody Blocking peptide

Sign In for Pricing
View Details
Rabbit Caspase-3/CPP32 ELISA Kit
ERTC0698 96 Tests

Rabbit Caspase-3/CPP32 ELISA Kit

Sign In for Pricing
View Details
Human PACRGL qPCR Primer Pair
QH62705S 200 Tests

Human PACRGL qPCR Primer Pair

Sign In for Pricing
View Details
Anti-Apolipoprotein E/APOE Antibody Picoband® Fluoro550 Conjugated
PB9327-Fluoro550 100 µg/Vial

Anti-Apolipoprotein E/APOE Antibody Picoband® Fluoro550 Conjugated

Sign In for Pricing
View Details