Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VPS8 Peptide - N-terminal region

VPS8 Peptide - N-terminal region

Product Specifications

UniProt

C9JP71

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with VPS8 Rabbit Polyclonal Antibody (orb325060) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SKFSYIDMDKELEFKNDLIDDKEFDIPQVDTPPTLESILNETDDEDESFI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Ppdpf shRNA (UAS) - Lentiviral mouse Ppdpf shRNA (UAS, RFP) (100)
GTR15291996 1 Vial

Lentiviral mouse Ppdpf shRNA (UAS) - Lentiviral mouse Ppdpf shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
Recombinant Human VAV1 Protein, N-GST
HB602012-01 50 µg

Recombinant Human VAV1 Protein, N-GST

Sign In for Pricing
View Details
Recombinant Human VAV1 Protein, N-GST
HB602012-02 100 µg

Recombinant Human VAV1 Protein, N-GST

Sign In for Pricing
View Details
Recombinant Human VAV1 Protein, N-GST
HB602012-03 1 mg

Recombinant Human VAV1 Protein, N-GST

Sign In for Pricing
View Details
CD38/ADPRC 1 & CD3E Bispecific Human Monoclonal Antibody
orb2976269-01 100 µg

CD38/ADPRC 1 & CD3E Bispecific Human Monoclonal Antibody

Sign In for Pricing
View Details
CD38/ADPRC 1 & CD3E Bispecific Human Monoclonal Antibody
orb2976269-02 1 mg

CD38/ADPRC 1 & CD3E Bispecific Human Monoclonal Antibody

Sign In for Pricing
View Details