CDS2 Peptide - C-terminal region
CDS2 Peptide - C-terminal region
Product Specifications
UniProt
E7EQ83
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CDS2 Rabbit Polyclonal Antibody (orb579766) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: EYNNDTNSFTVDCEPSDLFRLQEYNIPGVIQSVIGWKTVRMYPFQIHSIA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS157663-03 5x 0.1 mg
Recombinant Human ANXA2 protein, N - His tag
Sign In for Pricing
View Details 
MBS2050569-01 0.1 mL
Cy3-Linked Polyclonal Antibody to Alpha-Lactalbumin (aLA)
Sign In for Pricing
View Details