CDS2 Peptide - C-terminal region
CDS2 Peptide - C-terminal region
Product Specifications
UniProt
E7EQ83
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CDS2 Rabbit Polyclonal Antibody (orb579766) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: EYNNDTNSFTVDCEPSDLFRLQEYNIPGVIQSVIGWKTVRMYPFQIHSIA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
M1202-31E-ML490 100 µL
Macrophage Inflammatory Protein 1 beta (MIP-1b, CCL4) (MaxLight 490) discontinued
Sign In for Pricing
View Details 