Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DLL3 Peptide - C-terminal region

DLL3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

SCDO1

UniProt

Q9NYJ7

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DLL3 Rabbit Polyclonal Antibody (orb580010) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_982353

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LVCACAPGYMGARCEFPVHPDGASALPAAPPGLRPGDPQRYLLPPALGLL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Liver
CS623603 5x 5 µm

Frozen Tissue Sections, Liver

Sign In for Pricing
View Details
8-Hydroxy-7-iodoquinoline-5-sulfonic Acid
TRC-H943678-500MG 500 mg

8-Hydroxy-7-iodoquinoline-5-sulfonic Acid

Sign In for Pricing
View Details
Trypsin (PRSS3) (NM_007343) Human Over-expression Lysate
LY429349 100 µg

Trypsin (PRSS3) (NM_007343) Human Over-expression Lysate

Sign In for Pricing
View Details
Human Kallikrein 11 (KLK11) ELISA Kit
RDR-KLK11-Hu-01 96 Tests

Human Kallikrein 11 (KLK11) ELISA Kit

Sign In for Pricing
View Details
Human Kallikrein 11 (KLK11) ELISA Kit
RDR-KLK11-Hu-02 48 Tests

Human Kallikrein 11 (KLK11) ELISA Kit

Sign In for Pricing
View Details
WNT11 Human Gene Knockout Kit (CRISPR)
KN419688 1 Kit

WNT11 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details