Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GALNT10 Peptide - C-terminal region

GALNT10 Peptide - C-terminal region

Product Specifications

UniProt

Q86SR1

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GALNT10 Rabbit Polyclonal Antibody (orb580528) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: WREDIRPGDPQHTKKFCFDAISHTSPVTLYDCHSMKGNQLWKYRKDKTLY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CMTM1 Recombinant Protein (Rat)
RP195530 100 µg

CMTM1 Recombinant Protein (Rat)

Sign In for Pricing
View Details
Il36rn Rat Pre-designed siRNA Set A
HY-RS25358 1 Set

Il36rn Rat Pre-designed siRNA Set A

Sign In for Pricing
View Details
Rabbit Polyclonal CSB Antibody [Alexa Fluor 750]
NB100-61070AF750 0.1 mL

Rabbit Polyclonal CSB Antibody [Alexa Fluor 750]

Sign In for Pricing
View Details
HSV-1 ICP8 (10A3) FITC
sc-53329 FITC 200 µg/mL

HSV-1 ICP8 (10A3) FITC

Sign In for Pricing
View Details
Recombinant Neuronal Pentraxin II (NPTX2)
SIPA340Hu01-01 10 µg

Recombinant Neuronal Pentraxin II (NPTX2)

Sign In for Pricing
View Details
Recombinant Neuronal Pentraxin II (NPTX2)
SIPA340Hu01-02 50 µg

Recombinant Neuronal Pentraxin II (NPTX2)

Sign In for Pricing
View Details